<output id="rjrrf"></output>
    <form id="rjrrf"><span id="rjrrf"><track id="rjrrf"></track></span></form>

      <noframes id="rjrrf"><form id="rjrrf"><th id="rjrrf"></th></form>
      <form id="rjrrf"><th id="rjrrf"><progress id="rjrrf"></progress></th></form>

        <form id="rjrrf"></form>
        Agouti-related Protein (AGRP) (83-132) Amide (human)
        Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2(Cys5&Cys20 bridge , Cys12&Cys26 bridge , Cys19&Cys3
        One letter sequence:SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Cys5&Cys20 bridge , Cys12&Cys26 bridge , Cys19&Cys37 bridge , Cys23&Cys47 bridge , Cys28&Cys35 bridge)
        Molecular Formula:C235H362N76O67S11
        Literature Reference: