<output id="rjrrf"></output>
    <form id="rjrrf"><span id="rjrrf"><track id="rjrrf"></track></span></form>

      <noframes id="rjrrf"><form id="rjrrf"><th id="rjrrf"></th></form>
      <form id="rjrrf"><th id="rjrrf"><progress id="rjrrf"></progress></th></form>

        <form id="rjrrf"></form>
        CART (62-102), human, rat
        Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu(Cys13&Cys33 bridge , Cys7&Cys25 bridge , Cys27&Cys40 bridge)
        One letter sequence:YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys13&Cys33 bridge , Cys7&Cys25 bridge , Cys27&Cys40 bridge)
        Molecular Formula:C183H298N56O55S7
        Literature Reference: