<output id="rjrrf"></output>
    <form id="rjrrf"><span id="rjrrf"><track id="rjrrf"></track></span></form>

      <noframes id="rjrrf"><form id="rjrrf"><th id="rjrrf"></th></form>
      <form id="rjrrf"><th id="rjrrf"><progress id="rjrrf"></progress></th></form>

        <form id="rjrrf"></form>
        CART (55-102), rat
        Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu(Cys20&Cys40 bridge , Cys14&Cys32 bridge , Cys34&Cys47 bridge)
        One letter sequence:IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20&Cys40 bridge , Cys14&Cys32 bridge , Cys34&Cys47 bridge)
        Molecular Formula:C226H367N65O65S7
        Literature Reference: