<output id="rjrrf"></output>
    <form id="rjrrf"><span id="rjrrf"><track id="rjrrf"></track></span></form>

      <noframes id="rjrrf"><form id="rjrrf"><th id="rjrrf"></th></form>
      <form id="rjrrf"><th id="rjrrf"><progress id="rjrrf"></progress></th></form>

        <form id="rjrrf"></form>
        Amylin, rat
        Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2(Cys2&Cys7 bridge)
        One letter sequence:KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (C2&C7 bridge)
        Molecular Formula:C167H272N52O53S2
        Description:Diabetes-associated peptide.
        Literature Reference:J.D. Leffert et al., PNAS, 86, 3127 (1989); J. Asai et al., BBRC, 164, 400 (1989)