<cite id="thdh1"></cite><cite id="thdh1"><noframes id="thdh1">
<i id="thdh1"></i> <cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite><cite id="thdh1"></cite><ins id="thdh1"></ins>
<cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"></ins>
<cite id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite>
<ins id="thdh1"></ins>
[Tyr0] BNP (1-32), human
Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Leu-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Cys11&Cys27 bridge)
One letter sequence:YSPKMVQGSGCFGRKMDRLSSSSGLGCKVLRRH(Cys11&Cys27 bridge)
Molecular Formula:C152H253N51O44S4
Literature Reference: