<cite id="thdh1"></cite><cite id="thdh1"><noframes id="thdh1">
<i id="thdh1"></i> <cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite><cite id="thdh1"></cite><ins id="thdh1"></ins>
<cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"></ins>
<cite id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite>
<ins id="thdh1"></ins>
BNP (1-32), porcine
Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr(Cys10&Cys26 bridge)
One letter sequence:SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY(Cys10&Cys26 bridge)
Molecular Formula:C149H250N52O44S3
Literature Reference:T. Sudoh et al., BBRC, 155, 726 (1988)