<cite id="thdh1"></cite><cite id="thdh1"><noframes id="thdh1">
<i id="thdh1"></i> <cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite><cite id="thdh1"></cite><ins id="thdh1"></ins>
<cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"></ins>
<cite id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite>
<ins id="thdh1"></ins>
BNP (1-32), rat
Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Cys10&Cys26 bridge)
One letter sequence:NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Cys10&Cys26 bridge)
Molecular Formula:C146H239N47O44S3
Literature Reference:M. Kojima et al., BBRC, 159, 1420 (1989)