<cite id="thdh1"></cite><cite id="thdh1"><noframes id="thdh1">
<i id="thdh1"></i> <cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite><cite id="thdh1"></cite><ins id="thdh1"></ins>
<cite id="thdh1"><span id="thdh1"><cite id="thdh1"></cite></span></cite>
<ins id="thdh1"></ins>
<cite id="thdh1"><noframes id="thdh1"><cite id="thdh1"></cite>
<ins id="thdh1"></ins>
Fam-BNP (1-32), human
5Fam-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Cys10&Cys26 bridge)
One letter sequence:5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Cys10&Cys26 bridge)
Molecular Formula:C164H256N50O48S4
Literature Reference:T. Sudoh et al., BBRC, 159, 1427 (1989)